Protein Info for OKGIIK_12150 in Rhodanobacter sp. FW510-T8

Name: rph
Annotation: ribonuclease PH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 TIGR01966: ribonuclease PH" amino acids 6 to 240 (235 residues), 376.2 bits, see alignment E=2.5e-117 PF01138: RNase_PH" amino acids 14 to 144 (131 residues), 98.5 bits, see alignment E=4.3e-32 PF03725: RNase_PH_C" amino acids 162 to 228 (67 residues), 45.8 bits, see alignment E=4.7e-16

Best Hits

Swiss-Prot: 82% identical to RNPH_STRMK: Ribonuclease PH (rph) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K00989, ribonuclease PH [EC: 2.7.7.56] (inferred from 82% identity to sml:Smlt3855)

Predicted SEED Role

"Ribonuclease PH (EC 2.7.7.56)" in subsystem Heat shock dnaK gene cluster extended or tRNA processing (EC 2.7.7.56)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>OKGIIK_12150 ribonuclease PH (Rhodanobacter sp. FW510-T8)
MNSVTRPSGRASDQLRSVSIERHYTRHAEGSVLVSFGDTRVLCTASIEDRAPAWLRGKGE
GWVTAEYGMLPRATNTRTQREATRGGQGGRTMEIQRLIGRSLRACVNRQALGERVVTLDC
DVLQADGGTRTAAITGAYVALVDAVNLLMKRENLKRNPVVGAVAAVSVGIYKGVPVLDLD
YAEDSDCDTDMNVVMNDGGGFIEVQGTAEGHAFRRNEMDALLALAEKGIGELVAAQRTAL
AL