Protein Info for OKGIIK_12040 in Rhodanobacter sp. FW510-T8

Name: pilQ
Annotation: type IV pilus secretin PilQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 727 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF11741: AMIN" amino acids 53 to 138 (86 residues), 31.2 bits, see alignment E=3.8e-11 amino acids 171 to 270 (100 residues), 69.1 bits, see alignment E=6.3e-23 TIGR02515: type IV pilus secretin PilQ" amino acids 292 to 722 (431 residues), 503 bits, see alignment E=3.7e-155 PF07660: STN" amino acids 318 to 365 (48 residues), 35.3 bits, see alignment 1.6e-12 PF03958: Secretin_N" amino acids 392 to 469 (78 residues), 54.1 bits, see alignment E=3e-18 PF00263: Secretin" amino acids 556 to 722 (167 residues), 173.2 bits, see alignment E=7.6e-55

Best Hits

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (727 amino acids)

>OKGIIK_12040 type IV pilus secretin PilQ (Rhodanobacter sp. FW510-T8)
MTNHIQSVRGRVMRHACRYLSMCLLIVGAAWASVAVAATTTLKNISYDALPGGGVELRMD
FGGGPVPQPKIFTTNNPPRIAVDFSDTDNAAPRHLDIGKGSTSGVSAVSAGGRTRVVVEL
MRESSYRSRVDGNSLVLTVDNGSASQAVTTASTIDPTKALPSASNGPAISNIDFRRGPNG
EGRVLIDFSGSGANADMTRKGDKVLVTIDHASLPANLAQRLDTMDFATPVQSIVTRAGAG
GGARMEIAVKGNVETSAYQTANQYVVEVAPKRAEDKPADRLARLTQEPNYNGKRVTFNFQ
DIPVRSALQLIADISGLNLVASDSVGGSVTLRLVNVPWDQALDVILRAKSLDKRRNGNVV
WVAPQAELAKYEQDVADAKLKAQDTAELVTDYVPISYGKAADIAKLLTSGSMQGGGGAGG
GASTQRGFLSPRGSVSFDTRTNTLLLNDTPEKIKQLRELIAVLDKPVQQVLIESRIVVAS
DDFTRELGTKFGVTGRVNNTQFQNAAAATPALTAGLGGGNVTSGGLNVNLPVSPAAGTFG
LAILGANYAIDLELSAAQTEGRGEVISSPRVITANQQEAVIRQGQEIGYVTFQNSAGSGA
GSGTATVQFKDAVLELKVTPTITADNRVYLMINVKKDALAGYVDAPGSGKIPTIDTREIN
TSVLVDNGQTVVLGGIYEINKANTMTKVPGLGDIPGVGVLFRKTSRTNTKAELLIFVTPR
ILSASLQ