Protein Info for OKGIIK_12015 in Rhodanobacter sp. FW510-T8

Annotation: Colicin transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 628 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 309 to 335 (27 residues), see Phobius details PF13519: VWA_2" amino acids 100 to 203 (104 residues), 33 bits, see alignment E=2e-11 PF00092: VWA" amino acids 136 to 229 (94 residues), 25.1 bits, see alignment E=4.8e-09 PF07719: TPR_2" amino acids 405 to 437 (33 residues), 30.6 bits, see alignment (E = 5.7e-11) PF00515: TPR_1" amino acids 405 to 437 (33 residues), 35.3 bits, see alignment (E = 1.7e-12) PF13414: TPR_11" amino acids 411 to 443 (33 residues), 34.3 bits, see alignment (E = 3.9e-12)

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 38% identity to pfv:Psefu_1842)

Predicted SEED Role

"TPR domain protein in aerotolerance operon"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (628 amino acids)

>OKGIIK_12015 Colicin transporter (Rhodanobacter sp. FW510-T8)
MSELLQQFHFLRPWWLAALLALPLLGWLGTRRSTAQLELSRLVDAELLPHLLSGREGRRS
LPLWLFALGWTLCALALAGPAWSRVEQPLYASRAVQVVAISLSQHMLARDVTPSRLDRAR
YKARDLLHANQDGLNALVGYAGEAFVVAPLTADANSLDDLLDAMAPDTMPVDGDNAAAAI
ERGAALVRDGKAGGGSLVLITDQADAAADAAARKARAAGVQVSVLGVGTPQGGPVPMPDG
GFLRDAQGGMLLARRDDAALAALAAAGGGRYVAMTTDRGDIDALHAQLRNAKATLADGQH
GDQWQDRGAWLLLPLLPLVALAFRRGWLLSLPWVLLPLLPGTASATTWQDLWQRPDQQAA
QALRHGHAKRAQQLARDPAWRGAAAYRAGDYAAAAQALPQALGSDAAYNLGNTLAKQGAY
PQAIAAYDRALRLDPANADARANRQALEDWLRRQHPQPSDQKQHEGHDGQKNASSPGEQG
KAGKQDAKNPSSAAENAEPSGQSGQDGKSQSQDPSGKDESRQGKSESGGADQPAPQTAQQ
QAEQRAQAEQARQALKRQMDAALARPGERPSEHQLGAPAEDDPQAKLPADLRHALQRVPD
DPGALLRRKFELEYQQRHGGAPSEDQQP