Protein Info for OKGIIK_11965 in Rhodanobacter sp. FW510-T8

Name: mscL
Annotation: large-conductance mechanosensitive channel protein MscL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details PF01741: MscL" amino acids 3 to 133 (131 residues), 166.8 bits, see alignment E=1.3e-53 TIGR00220: large conductance mechanosensitive channel protein" amino acids 3 to 135 (133 residues), 158.3 bits, see alignment E=5.4e-51

Best Hits

Swiss-Prot: 67% identical to MSCL_STRMK: Large-conductance mechanosensitive channel (mscL) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 67% identity to sml:Smlt3782)

MetaCyc: 57% identical to large conductance mechanosensitive channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (136 amino acids)

>OKGIIK_11965 large-conductance mechanosensitive channel protein MscL (Rhodanobacter sp. FW510-T8)
MSMISEFKAFAMRGNVIDLAVGVVIGGAFGKIVTSLVDQIIMPPIGWLTGGIDFSAMKWV
LKPGDDSDPKHKIAEVAVQYGAFINTLIQFIIIAFAIFMVVKAINKLSRKEEAAPAAPPA
DVALLTEIRDLLKNKP