Protein Info for OKGIIK_11960 in Rhodanobacter sp. FW510-T8

Annotation: Fumarylacetoacetate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01557: FAA_hydrolase
  • amino acids 26 to 228 (203 residues), 174.6 bits, E=1.2e-55

Best Hits

Swiss-Prot: 40% identical to FAHD1_RAT: Acylpyruvase FAHD1, mitochondrial (Fahd1) from Rattus norvegicus

KEGG orthology group: None (inferred from 56% identity to bte:BTH_II1389)

MetaCyc: 40% identical to fumarylpyruvate hydrolase (Ralstonia sp. U2)
RXN-10445 [EC: 3.7.1.20]

Predicted SEED Role

"Fumarylacetoacetate hydrolase family protein" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

MetaCyc Pathways

• gentisate degradation I (2/3 steps found)
• 5-nitroanthranilate degradation (3/6 steps found)
• 3-phenylpropanoate degradation (5/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.20

Protein Sequence (228 amino acids)

>OKGIIK_11960 Fumarylacetoacetate hydrolase (Rhodanobacter sp. FW510-T8)
MNYAIAPPAIPSLPIIGSDRRFPIRRVFCIGRNYAEHAREMGATVDRSAPMFFCKPADAV
VADGADVPYPQATADLHHEVEMVVALGAGGRDLAPGEAAALVWGYGVGLDLTRRDLQAQA
KAKGHPWDVGKGFDHSAPVSALRPAGEVAVDARTVLRLSVNGELRQQATLGEMVHDVPHI
LTALSTLFELQAGDLVFTGTPAGVAALRRGDRFHAELVGVAELDGRVV