Protein Info for OKGIIK_11805 in Rhodanobacter sp. FW510-T8

Name: ccmA
Annotation: heme ABC exporter ATP-binding protein CcmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 620 PF00005: ABC_tran" amino acids 19 to 178 (160 residues), 88.6 bits, see alignment E=3.8e-28 amino acids 329 to 462 (134 residues), 80.7 bits, see alignment E=9.8e-26 PF13304: AAA_21" amino acids 145 to 209 (65 residues), 27.5 bits, see alignment E=1.8e-09 PF12848: ABC_tran_Xtn" amino acids 217 to 287 (71 residues), 40.2 bits, see alignment E=1.8e-13 PF16326: ABC_tran_CTD" amino acids 551 to 619 (69 residues), 74.8 bits, see alignment E=3.2e-24

Best Hits

Swiss-Prot: 55% identical to UUP_ECOLI: ABC transporter ATP-binding protein uup (uup) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 68% identity to psu:Psesu_1448)

Predicted SEED Role

"COG0488: ATPase components of ABC transporters with duplicated ATPase domains" in subsystem Folate Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (620 amino acids)

>OKGIIK_11805 heme ABC exporter ATP-binding protein CcmA (Rhodanobacter sp. FW510-T8)
MSLIQLQCVDFSIGGPLLLEHVDLSIEANERVCIVGRNGEGKSTLMKLIAGELQADDGEV
RIQNGVVVARMAQEVPQGTAGSVFDVVAEGLGDLGHLLARYHHLLAEGDFDALGDVQHQI
EAQHGWDLDRRVSDVLTQLELPGDTDFAALSGGMKRRVLLAQALVRKPDVLLLDEPTNHL
DIEAIGWLETFLKQFAGSIIFVTHDRSFLRALATRIVEIDRGALTDWPGDYDNYLRRREE
RLHAEAQANALFDKKLAQEEVWIRQGIKARRTRNEGRVRALKALRNERAQRRELGGNVKM
TAANAQASGKKVIDLDHVRQAYGGRVLIENLTTTVMRGDRIGIIGPNGAGKSTLLKIMLG
ELKPQRGTAELGTGIQIAYFDQHRLQLNDQLNALDNVAEGREYIELNGQRKHIIGYLQDF
LFSPERARAPITRLSGGERNRLLLAKLFAQPSNLLVMDEPTNDLDVETLELLEELLTDYQ
GTLLLVSHDRAFLDNVVSSTLVLEGEGRVGEYVGGYTDWLRQRPAARSTPATGKSATPAP
APAAPVAAKRKRSFKEQHELEQLPKRIEQLEGDIAARTAAMNEPTFFQQDSAAIVKANEA
LAALQAELDAAYARWTELDS