Protein Info for OKGIIK_11705 in Rhodanobacter sp. FW510-T8

Annotation: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-di aminopimelate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 TIGR01085: UDP-N-acetylmuramyl-tripeptide synthetase" amino acids 28 to 493 (466 residues), 532.2 bits, see alignment E=6.4e-164 PF01225: Mur_ligase" amino acids 29 to 105 (77 residues), 35.8 bits, see alignment E=1.3e-12 PF08245: Mur_ligase_M" amino acids 117 to 319 (203 residues), 180.2 bits, see alignment E=7.5e-57 PF02875: Mur_ligase_C" amino acids 340 to 426 (87 residues), 84.7 bits, see alignment E=7.1e-28

Best Hits

Swiss-Prot: 58% identical to MURE_XANCP: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (murE) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K01928, UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [EC: 6.3.2.13] (inferred from 58% identity to xcc:XCC0721)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC 6.3.2.13)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (502 amino acids)

>OKGIIK_11705 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-di aminopimelate ligase (Rhodanobacter sp. FW510-T8)
MSTGHLDQLLLGIADAQVAAVPGAGRIVVSGLALDSRRVQRGDAFFALRGTRDHGITFAP
GAVQRGARVVLAEAPVAGDVAALEVPVLWIDGLHGQVGEIAARFYERPSESMRMVGVTGT
NGKTSCVQLLAQALTLLGHRAASIGTLGAGVHGRLREGERTTPDAISVQALLAEFRDAGA
SHVAMEVSSHALEQGRVAAVDFEVAVFTNLTRDHLDYHGSMEAYGAAKAKLFAWPGLRSA
VVNIDDAFGRELAGQLPPGVQRLRFSMAGDGEAEVAAGAIATSAEGLSFTLRTPWGTRAV
RSHLIGRFNVANLLAVAACLGALGEPFARIVEAVGQLQPVNGRMSRLGGLHGQPLVVVDY
AHTPDALEQALAAVRAHCAGKLICVFGCGGERDAGKRPLMGEIAARLADVAIVTDDNPRG
EDGDAIVAQIVAGMAAARAMAVERDRATAIADALQLARSGDVVLIAGKGHETYQEGATGK
HPFDDLAVARAVLERIGGEARP