Protein Info for OKGIIK_11600 in Rhodanobacter sp. FW510-T8
Annotation: ATP:cob(I)alamin adenosyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 60% identical to ATR_CUPMC: Cobalamin adenosyltransferase (cobO) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
KEGG orthology group: K00798, cob(I)alamin adenosyltransferase [EC: 2.5.1.17] (inferred from 71% identity to psu:Psesu_0598)Predicted SEED Role
"ATP:Cob(I)alamin adenosyltransferase (EC 2.5.1.17)" (EC 2.5.1.17)
MetaCyc Pathways
- superpathway of adenosylcobalamin salvage from cobinamide I (8/8 steps found)
- adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (6/6 steps found)
- superpathway of adenosylcobalamin salvage from cobinamide II (8/9 steps found)
- adenosylcobalamin salvage from cobalamin (5/5 steps found)
- adenosylcobinamide-GDP salvage from cobinamide I (5/5 steps found)
- adenosylcobinamide-GDP salvage from cobinamide II (5/6 steps found)
- cobalamin salvage (eukaryotic) (4/8 steps found)
- adenosylcobalamin biosynthesis II (aerobic) (21/33 steps found)
- adenosylcobalamin biosynthesis I (anaerobic) (20/36 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.5.1.17
Use Curated BLAST to search for 2.5.1.17
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (190 amino acids)
>OKGIIK_11600 ATP:cob(I)alamin adenosyltransferase (Rhodanobacter sp. FW510-T8) MGNRLSKIYTRTGDDGSTGLGDGSRVGKDSLRVNAYGTVDELNSTIGMLLASDGVGDEVR EALTQVQHDLFDLGGELCIPGMAMVEDSDIERLERILDTLNEPLPPLKEFILPGGGMAAA CGHLARTVCRRAEREVIALSRAEEIRRQPQRYLNRLSDLLFVISRVLARASGHGEVLWQH ERRRKPKPAG