Protein Info for OKGIIK_11590 in Rhodanobacter sp. FW510-T8

Name: ubiH
Annotation: 2-octaprenyl-6-methoxyphenyl hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 14 to 347 (334 residues), 112.2 bits, E=1.7e-36
• TIGR01988: ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family
  • amino acids 14 to 395 (382 residues), 350.1 bits, E=7e-109

Best Hits

KEGG orthology group: K03185, 2-octaprenyl-6-methoxyphenol hydroxylase [EC: 1.14.13.-] (inferred from 54% identity to psu:Psesu_0600)

MetaCyc: 51% identical to 4-hydroxy-3-polyprenylbenzoate 5-hydroxylase (Xanthomonas campestris pv. campestris)
1.14.13.M81 [EC: 1.14.13.M81]

Predicted SEED Role

"2-octaprenyl-6-methoxyphenol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

MetaCyc Pathways

• ubiquinol-8 biosynthesis (late decarboxylation) (7/9 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Bisphenol A degradation
• Brassinosteroid biosynthesis
• Carotenoid biosynthesis - General
• Cyanoamino acid metabolism
• Flavonoid biosynthesis
• Histidine metabolism
• Isoflavonoid biosynthesis
• Limonene and pinene degradation
• Methane metabolism
• Naphthalene and anthracene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Styrene degradation
• Toluene and xylene degradation
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.13.M81

Protein Sequence (409 amino acids)

>OKGIIK_11590 2-octaprenyl-6-methoxyphenyl hydroxylase (Rhodanobacter sp. FW510-T8)
MNVPEAPAPNGSGVLIVGGGLVGASLAIALDVAGVAATLVETAAPRADAQPSYDERNLAL
ARATVNGLAAIGVWRHAAARATPIRYIHVSRAGEFGSARIDADKQGVDALGWTLPARELG
AALSRRLDECTRLTRLAPATLSALQPLAGGWRAQVETAGGAHSLDTPLLVGADGTQSFVR
AQLGIDAERHDYRQTLFVCTVTPERDHANRAWERFGDEGPVALLPLAERRCGLVLTVATD
EAEKVAALDDAGFIELAQRRFGWRLGRLGRPGRRHPYAIQRVAATRLTAPRAVLVGNAAQ
TVHPIGAQGFNLGLRDALTLAELVAAAPDPGAADLLARYAARRAPDREGTMAMSHGLVQL
ACLPQPLLAPLRSLALLACDRLPPLQRALARRGMGFRGQPPLAVLERLP