Protein Info for OKGIIK_10725 in Rhodanobacter sp. FW510-T8

Annotation: Nucleotidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 96 PF01909: NTP_transf_2" amino acids 13 to 94 (82 residues), 50 bits, see alignment E=3.4e-17 PF18765: Polbeta" amino acids 16 to 93 (78 residues), 38.6 bits, see alignment E=1e-13

Best Hits

Swiss-Prot: 37% identical to Y435_METJA: Uncharacterized protein MJ0435 (MJ0435) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07075, (no description) (inferred from 68% identity to pna:Pnap_3948)

Predicted SEED Role

"FIG188645: PAP/25A core domain:DNA polymerase, beta-like region"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (96 amino acids)

>OKGIIK_10725 Nucleotidyltransferase (Rhodanobacter sp. FW510-T8)
MLLDALHAQKDAINAACRQYGARRIRVFGSVARGEEQPDSDIDFLVDFPRGYDLFAQRLA
LAERLVEITGRQLDVIPEHELNRHIRARVLQEAVDL