Protein Info for OKGIIK_10400 in Rhodanobacter sp. FW510-T8

Name: rpsN
Annotation: 30S ribosomal protein S14

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 PF00253: Ribosomal_S14" amino acids 47 to 100 (54 residues), 82.1 bits, see alignment E=9.1e-28

Best Hits

Swiss-Prot: 78% identical to RS14_STRM5: 30S ribosomal protein S14 (rpsN) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K02954, small subunit ribosomal protein S14 (inferred from 78% identity to smt:Smal_0769)

MetaCyc: 60% identical to 30S ribosomal subunit protein S14 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S14p (S29e) @ SSU ribosomal protein S14p (S29e), zinc-independent"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (101 amino acids)

>OKGIIK_10400 30S ribosomal protein S14 (Rhodanobacter sp. FW510-T8)
MAKTSMVNRDIKRTKLAQKFAAKRAELKAIVLSPGASYEEKMAAQSKLQKLPRDASPVRQ
RTRCALTGRPRAVYSKFGLGRNKLREATMRGDVPGLRKASW