Protein Info for OKGIIK_10380 in Rhodanobacter sp. FW510-T8

Name: rpsE
Annotation: 30S ribosomal protein S5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01021: ribosomal protein uS5
  • amino acids 12 to 164 (153 residues), 211 bits, E=4.1e-67
• PF00333: Ribosomal_S5
  • amino acids 13 to 76 (64 residues), 94.2 bits, E=3.8e-31
• PF03719: Ribosomal_S5_C
  • amino acids 89 to 158 (70 residues), 98.5 bits, E=1.2e-32

Best Hits

Swiss-Prot: 80% identical to RS5_XANCP: 30S ribosomal protein S5 (rpsE) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K02988, small subunit ribosomal protein S5 (inferred from 82% identity to psu:Psesu_2318)

MetaCyc: 75% identical to 30S ribosomal subunit protein S5 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S5p (S2e)" in subsystem Ribosomal protein S5p acylation or Ribosome SSU bacterial

Protein Sequence (169 amino acids)

>OKGIIK_10380 30S ribosomal protein S5 (Rhodanobacter sp. FW510-T8)
MSSTDRENSDGLLEKLIAVNRVAKTVKGGRQMSFTALTVVGDGEGKVGFGYGKAREVPVA
ISKAMERARRQMVNIELNNGTLWYAVKANHGAARVYMQPASEGTGVIAGGAMRAVLEVVG
VKNVLAKAVGSRNPINLVRATIKGLQAVASPKKIAAKRGKTLEEVLGNG