Protein Info for OKGIIK_10040 in Rhodanobacter sp. FW510-T8

Name: upp
Annotation: uracil phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01091: uracil phosphoribosyltransferase
  • amino acids 3 to 208 (206 residues), 272.1 bits, E=1.5e-85
• PF14681: UPRTase
  • amino acids 7 to 207 (201 residues), 220.1 bits, E=2.3e-69
• PF00156: Pribosyltran
  • amino acids 46 to 172 (127 residues), 50.8 bits, E=1.3e-17

Best Hits

Swiss-Prot: 76% identical to UPP_GEOLS: Uracil phosphoribosyltransferase (upp) from Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)

KEGG orthology group: K00761, uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 76% identity to glo:Glov_1078)

MetaCyc: 66% identical to uracil phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Uracil phosphoribosyltransferase. [EC: 2.4.2.9]

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9)" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• pyrimidine nucleobases salvage I (1/1 steps found)
• superpathway of pyrimidine ribonucleosides salvage (7/10 steps found)
• pyrimidine nucleobases salvage II (1/2 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.9

Protein Sequence (214 amino acids)

>OKGIIK_10040 uracil phosphoribosyltransferase (Rhodanobacter sp. FW510-T8)
MKIAEVRHPLIQHKLGLMRRAGISTKDFRELASEVAALLTYEATKDLETVEEQIQGWAGP
LLVHRIKGKKITIVPILRAGLGMLPGVLDMIPAAKVSVVGLQRDEHSLQPVAYYEKLSGR
MDERIALIVDPMLATAGTLVATVEMLKAAGCKRIKGLFLVAAPEGLKRIEAVHPEIEIYT
AAIDERLNEHGYILPGLGDAGDKIFGTKQLPAND