Protein Info for OKGIIK_09465 in Rhodanobacter sp. FW510-T8

Name: argG
Annotation: argininosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00764: Arginosuc_synth" amino acids 5 to 157 (153 residues), 112.6 bits, see alignment E=2e-36 PF20979: Arginosuc_syn_C" amino acids 175 to 390 (216 residues), 152.1 bits, see alignment E=1.8e-48

Best Hits

Swiss-Prot: 86% identical to ASSY_XANCP: Argininosuccinate synthase (argG) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 86% identity to xca:xccb100_1932)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>OKGIIK_09465 argininosuccinate synthase (Rhodanobacter sp. FW510-T8)
MSKDIVLAFSGGLDTSFCVPYLKERGWAVHTVFADTGGVDAEERAFIEHRAQELGVASHV
TVDGGPAIWAGFVKPFVWAGEGYQGQYPLLVSDRYLIVEAALKRAAELGTKAIAHGCTGM
GNDQVRFDLAVKSLGDYEIVAPIREIQKEHTQTRAYEQKFLEERGFGVRAKQQAYTINEN
LLGVTMSGGEIDKWEAPGEGARGWCKPRAEWPAAPLRVKIGFEKGEAVSLDGEKLAGHQL
LAKLNALFAPYGVGRGLYTGDTTIGLKGRIIFEAPGLISLLTAHRALEEAVLSKQQNRFK
PDVARKWVEVVYEGFFHDPLKADLEAFLASSQSTVNGEVTLETNGGVVNAVAVASKHILN
AKGATYAQSADWGVAEAEGFIKLFGMSSTLWAEVNR