Protein Info for OKGIIK_09435 in Rhodanobacter sp. FW510-T8

Name: argC
Annotation: N-acetyl-gamma-glutamyl-phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 TIGR01850: N-acetyl-gamma-glutamyl-phosphate reductase" amino acids 7 to 318 (312 residues), 300.8 bits, see alignment E=6.8e-94 PF01118: Semialdhyde_dh" amino acids 8 to 123 (116 residues), 82.5 bits, see alignment E=3.3e-27 PF22698: Semialdhyde_dhC_1" amino acids 136 to 290 (155 residues), 132.6 bits, see alignment E=1.3e-42

Best Hits

Swiss-Prot: 72% identical to ARGC_STRMK: N-acetyl-gamma-glutamyl-phosphate reductase (argC) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 72% identity to sml:Smlt3297)

Predicted SEED Role

"N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)" in subsystem Arginine Biosynthesis extended (EC 1.2.1.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.- or 1.2.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>OKGIIK_09435 N-acetyl-gamma-glutamyl-phosphate reductase (Rhodanobacter sp. FW510-T8)
VTNDKKSIGIVGARGHTGVELIRLIAAHPALELAFVSSRELDGQCVADHVDGFAGGLRYA
SLDPAAVAAQGADVVILALPNGKAAPFVAAIGAAKPDTLILDLSADYRFDKTWYYGLPEL
TRGKWRGEKRISNPGCYATAMQLSVAPLKDLLAAPPVCFGVSGYSGAGTTPSDKNDPDKL
RDNLMPYALTGHMHEKEASFQLGVPVEFMPHVAPHFRGLTVTSNLYLSRPMKREEVLQRF
RHAYGDEKLVSVLDEAPWVSRIAHKHHTEIGGFALSADGKRVVIVATLDNLLKGAATQAM
QNINRAIGVDEYTAIPVEP