Protein Info for OKGIIK_09410 in Rhodanobacter sp. FW510-T8

Name: lolD
Annotation: ABC-type lipoprotein export system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 20 to 169 (150 residues), 116 bits, E=2.2e-37

Best Hits

Swiss-Prot: 50% identical to LOLD_GEOMG: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)

KEGG orthology group: K02003, (no description) (inferred from 61% identity to net:Neut_0974)

MetaCyc: 40% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Protein Sequence (231 amino acids)

>OKGIIK_09410 ABC-type lipoprotein export system, ATPase component (Rhodanobacter sp. FW510-T8)
VRCRGLTKRYGSGDERVDALRGVDLDVRSGELLMLVGPSGCGKTTLISIITTILDQDDGT
CEVLGRDVGCMPESERTRFRGEAIGFVFQAFNLLPALTAVENVSVPLLLSGMAREAAEKR
ARSVLEEVGLAARADALPRKLSGGQQQRVAIGRALVHDPKLVVCDEPTSNLDAKTGHEMM
DILRGVARAPGRALIVVTHDNRTFGYADRMARMEDGRVVEVSDGERQEVQP