Protein Info for OKGIIK_09395 in Rhodanobacter sp. FW510-T8

Name: kynU
Annotation: kynureninase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01814: kynureninase
  • amino acids 12 to 427 (416 residues), 472.5 bits, E=5.5e-146
• PF00266: Aminotran_5
  • amino acids 55 to 379 (325 residues), 42.1 bits, E=5.8e-15
• PF22580: KYNU_C
  • amino acids 332 to 423 (92 residues), 89 bits, E=1.7e-29

Best Hits

Swiss-Prot: 67% identical to KYNU_XANC5: Kynureninase (kynU) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K01556, kynureninase [EC: 3.7.1.3] (inferred from 67% identity to xcv:XCV1642)

Predicted SEED Role

"Kynureninase (EC 3.7.1.3)" in subsystem NAD and NADP cofactor biosynthesis global (EC 3.7.1.3)

MetaCyc Pathways

• NAD de novo biosynthesis II (from tryptophan) (7/9 steps found)
• L-tryptophan degradation to 2-amino-3-carboxymuconate semialdehyde (4/5 steps found)
• L-tryptophan degradation I (via anthranilate) (2/3 steps found)
• 3-hydroxy-4-methyl-anthranilate biosynthesis II (3/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (9/14 steps found)
• L-tryptophan degradation III (eukaryotic) (9/15 steps found)
• L-tryptophan degradation IX (6/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (5/12 steps found)
• L-tryptophan degradation XI (mammalian, via kynurenine) (10/23 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (6/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (5/42 steps found)

KEGG Metabolic Maps

• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.3

Protein Sequence (431 amino acids)

>OKGIIK_09395 kynureninase (Rhodanobacter sp. FW510-T8)
MSASFEATLDWAQARDAADPLRAFRDEFLIPPHEGHDSRPSDSVYFCGNSLGLQPRAVRE
AVNAELDYWGELAVEGHFKGRLPWMDYHEFVRDDLAAVVGARPAEVVAMNTLGVNLHLMM
VSFYRPTPERHAILIEAGAFPTDRYAVESQVRFHGFSPALSLIELEADEPNGTTSMQAIE
RALAEHGEQIALVLLPGVQYRTGQAFDLKAISALGHRHGCTVGFDLAHAVGNLPLQLHDS
GADFAIWCSYKYLNSGPGAIGGAFVHERHATAALPRFAGWWGHDKTTRFQMGPEFHPTPG
ADGWQLSNPPILALAPLRVSLEIFRRAGMDRLREKSLQLTGYLEWLVQTQLADVLQVVTP
AEPDRRGAQLSIRVTGGRERGRALFEYLMAHGIIGDWREPDVIRISPAPLYNRFADCLAF
AEAVREWSRSV