Protein Info for OKGIIK_09185 in Rhodanobacter sp. FW510-T8

Name: metH1
Annotation: 5-methyltetrahydrofolate--homocysteine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02574: S-methyl_trans
  • amino acids 24 to 347 (324 residues), 324.4 bits, E=4.8e-101

Best Hits

KEGG orthology group: K00548, 5-methyltetrahydrofolate--homocysteine methyltransferase [EC: 2.1.1.13] (inferred from 68% identity to xca:xccb100_2760)

Predicted SEED Role

"5-methyltetrahydrofolate--homocysteine methyltransferase (EC 2.1.1.13)" in subsystem Methionine Biosynthesis (EC 2.1.1.13)

MetaCyc Pathways

• aspartate superpathway (21/25 steps found)
• folate transformations III (E. coli) (9/9 steps found)
• folate transformations II (plants) (10/11 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (15/18 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (6/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (6/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (5/8 steps found)
• L-methionine biosynthesis III (2/4 steps found)
• L-methionine salvage from L-homocysteine (1/3 steps found)
• folate transformations I (8/13 steps found)
• L-methionine biosynthesis I (2/5 steps found)
• superpathway of L-methionine salvage and degradation (8/16 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.13

Use Curated BLAST to search for 2.1.1.13

Protein Sequence (363 amino acids)

>OKGIIK_09185 5-methyltetrahydrofolate--homocysteine methyltransferase (Rhodanobacter sp. FW510-T8)
MSTLPWLHPDRVALLEQTLQRRILILDGGMGTMLQAHELDEHGFRGERFQHGHDGHAHDG
HAHEHPGGCDLKGNNDLLTLTKPEIIRGVHDAYLEAGADLIETNTFNSTRISQADYKLQQ
LAYELNREGAKLARAACDAMTAKTPDQPRFVIGVLGPTSRTASLSPDVNDPGFRNVTFEE
LAENYTESANGLIDGGADVIMVETIFDTLNAKAALFALSELFHQRGARLPVMVSGTITDR
SGRTLSGQTAEAFYYSVRHARPLSVGFNCALGAEDLRPHVQTLANLAESYVSTHPNAGLP
NAFGEYDETPEHMAGVIAGFARDGLLNLVGGCCGTTPAHIRAIAEAVRDCAPRALPGVVQ
EAA