Protein Info for OKGIIK_09155 in Rhodanobacter sp. FW510-T8

Name: nadK
Annotation: NAD kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 13 (13 residues), see Phobius details PF01513: NAD_kinase" amino acids 29 to 71 (43 residues), 29.7 bits, see alignment 7.2e-11 PF20143: NAD_kinase_C" amino acids 111 to 199 (89 residues), 44 bits, see alignment E=1.8e-15

Best Hits

Swiss-Prot: 62% identical to NADK_XYLFA: NAD kinase (nadK) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K00858, NAD+ kinase [EC: 2.7.1.23] (inferred from 62% identity to psu:Psesu_1457)

Predicted SEED Role

"NAD kinase (EC 2.7.1.23)" in subsystem NAD and NADP cofactor biosynthesis global (EC 2.7.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>OKGIIK_09155 NAD kinase (Rhodanobacter sp. FW510-T8)
MRFAFVASDASVAQQAWRKLVERYGDVPPEQAELIVALGGDGFMLRTLHAYRALELPVYG
MKLGRVGFLMNKHRLDGLPERIARAHAATLFPLQMEVTDVAGNEHSALAFNEVSLLRQSN
QAAHLEVQLNGTVKLPNLVCDGIMVATPAGSTAYNLSAHGPILPLDANVLALTPISPFRP
RRWRGAILPHRTEVVLRVLDPGKRPVSATADFHEVRDVRAVAIRQSGGQGVRLLFDPEHN
LEQRILDEQFASE