Protein Info for OKGIIK_08260 in Rhodanobacter sp. FW510-T8

Name: gstA
Annotation: glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF02798: GST_N" amino acids 22 to 98 (77 residues), 50.9 bits, see alignment E=3.9e-17 PF13417: GST_N_3" amino acids 27 to 102 (76 residues), 46.4 bits, see alignment E=9.7e-16 PF13409: GST_N_2" amino acids 28 to 99 (72 residues), 53 bits, see alignment E=1e-17 PF00043: GST_C" amino acids 144 to 222 (79 residues), 31.8 bits, see alignment E=3.5e-11 PF13410: GST_C_2" amino acids 151 to 217 (67 residues), 29.2 bits, see alignment E=2e-10

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 79% identity to swi:Swit_0234)

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>OKGIIK_08260 glutathione S-transferase (Rhodanobacter sp. FW510-T8)
VTRLSDFPVSTRWPAQHPDRIQLYSLNSPNGVKVSIMLEETGLPYEPHLVDIGKNESHTP
EFLALNPNGKIPAIIDPHGPGGEPLALFESGAILLYLADKAGQFIPADPARRWETIQWLF
FQMASIGPMFGQVGFFNKFAGKAYEDKRPLERYVNESKRLLGVLDGRLAGRRWLMGEDYT
IADIATLGWVNNLITLYEARELVAFDRFANVGGWLERGLARPAVQRGLTIPGRG