Protein Info for OKGIIK_08130 in Rhodanobacter sp. FW510-T8

Name: truD
Annotation: tRNA pseudouridine(13) synthase TruD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01142: TruD
  • amino acids 6 to 166 (161 residues), 150.9 bits, E=2.6e-48
  • amino acids 182 to 332 (151 residues), 63.3 bits, E=1e-21
• TIGR00094: tRNA pseudouridine synthase, TruD family
  • amino acids 11 to 230 (220 residues), 178.1 bits, E=1.9e-56

Best Hits

Swiss-Prot: 52% identical to TRUD_NITOC: tRNA pseudouridine synthase D (truD) from Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107)

KEGG orthology group: K06176, tRNA pseudouridine synthase D [EC: 5.4.99.12] (inferred from 62% identity to psu:Psesu_0898)

Predicted SEED Role

"tRNA pseudouridine 13 synthase (EC 4.2.1.-)" in subsystem tRNA processing (EC 4.2.1.-)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-, 5.4.99.12

Use Curated BLAST to search for 4.2.1.- or 5.4.99.12

Protein Sequence (338 amino acids)

>OKGIIK_08130 tRNA pseudouridine(13) synthase TruD (Rhodanobacter sp. FW510-T8)
VQELPYAFGEPPLTARLRASPEDFQVEEILGYDADGAGEHALLWVEKRGANTDWVARELA
KFAGVPQVAVGYAGMKDRHAVTRQAFSVQLAGKPDPDWSAFPRAEVKVLAATRHSRKLKR
GALRGNRFVLVLREVQGDRTAAERVLEQIAARGVPNYFGEQRFGREGGNVAQARAMFGGR
RVDRDKRSFLLSAARSQIFNGVLAARVKRGAWDSPLDGEIWSLAGSRSWFGPEPFDATLA
ERLARGDIHPSGPLWGQGEPPSQGEAGALEREIGAANSDLADGLAAARMEQERRPLRLLP
KDLRWHWLGDDALELSFELPAGAYATVVVRELASSTAT