Protein Info for OKGIIK_07870 in Rhodanobacter sp. FW510-T8

Name: rnc
Annotation: ribonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 TIGR02191: ribonuclease III" amino acids 3 to 213 (211 residues), 230.4 bits, see alignment E=9.3e-73 PF14622: Ribonucleas_3_3" amino acids 10 to 130 (121 residues), 114.9 bits, see alignment E=4.3e-37 PF00636: Ribonuclease_3" amino acids 29 to 119 (91 residues), 82.6 bits, see alignment E=4.6e-27 PF00035: dsrm" amino acids 145 to 213 (69 residues), 45.3 bits, see alignment E=1.7e-15

Best Hits

Swiss-Prot: 58% identical to RNC_XANC8: Ribonuclease 3 (rnc) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 62% identity to psu:Psesu_1987)

MetaCyc: 47% identical to RNase III (Escherichia coli K-12 substr. MG1655)
Ribonuclease III. [EC: 3.1.26.3]

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.3

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>OKGIIK_07870 ribonuclease III (Rhodanobacter sp. FW510-T8)
LSELNYRFRDPALAQLALTHRSVGKPNNERLEFLGDALLGAVVAEMLYEAHPKASEGELS
RLRAQLVNGQALAVMARELALGDGLKLGPGELKSGGFRRDSILADAFEATVAAVYLDGGF
DACRETVRGLFVGRIAALRRSSKDAKTRLQEWLQAKGLPLPQYELIASHGEDHAKTFDVS
CTVAEPLAFTAEARGGNRRAAEQDAAETVLNRLLEQQRDA