Protein Info for OKGIIK_07730 in Rhodanobacter sp. FW510-T8

Name: rhtA
Annotation: Threonine/homoserine efflux transporter RhtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 112 to 128 (17 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details PF00892: EamA" amino acids 2 to 125 (124 residues), 27.7 bits, see alignment E=1.4e-10 amino acids 139 to 268 (130 residues), 67 bits, see alignment E=1e-22

Best Hits

KEGG orthology group: None (inferred from 64% identity to pmk:MDS_2248)

Predicted SEED Role

"Putative DMT superfamily metabolite efflux protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>OKGIIK_07730 Threonine/homoserine efflux transporter RhtA (Rhodanobacter sp. FW510-T8)
MLLVSMVSYQCGASLAKHLFPQVGAQGATAYRLGLSALILLLWRRPWRRSGPGQGAGRRD
WRALWGYGLSMGAMNLVFYMSLHTIPLGIAVALEFTGPLALALLGSRRWLDFVWIALVVA
GLALLLPLRGQVQTLDPVGVMYALGAGVGWALYIVLGKQAGAAHGADAVTMGTSIGALLA
IPFGVAHAGSALLTPVLLPYALGVAVLSSALPYSLEMVALTRLPARTFSTLLSLEPAIAA
VAGVALLGERLSLLQWLAIGAIIVAAAGTALSLQRPALAEPLAN