Protein Info for OKGIIK_07670 in Rhodanobacter sp. FW510-T8

Name: ccoP
Annotation: cytochrome-c oxidase, cbb3-type subunit III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details PF14715: FixP_N" amino acids 39 to 85 (47 residues), 41.3 bits, see alignment 1.5e-14 TIGR00782: cytochrome c oxidase, cbb3-type, subunit III" amino acids 39 to 293 (255 residues), 226.6 bits, see alignment E=2e-71 PF13442: Cytochrome_CBB3" amino acids 129 to 203 (75 residues), 42.3 bits, see alignment E=1.2e-14 amino acids 216 to 290 (75 residues), 45.1 bits, see alignment E=1.5e-15 PF00034: Cytochrom_C" amino acids 131 to 207 (77 residues), 30.8 bits, see alignment E=9.3e-11 amino acids 216 to 291 (76 residues), 36 bits, see alignment E=2.1e-12

Best Hits

Swiss-Prot: 48% identical to CCOP_RUBGE: Cbb3-type cytochrome c oxidase subunit CcoP (ccoP) from Rubrivivax gelatinosus

KEGG orthology group: None (inferred from 53% identity to gpb:HDN1F_27240)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoP (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>OKGIIK_07670 cytochrome-c oxidase, cbb3-type subunit III (Rhodanobacter sp. FW510-T8)
VSAGWSFWVMFLVVLNMGITFFLYLWGPRAKIPTLPDGTSGHVWAHGVLREGVRPLPMWW
VLFSGAMFVAGFVYLALFPGFGNFKGVLGWTSHDELARHVAANRAELAPLMDRFKLYPVE
QLAADPKALQMGKVLFEDNCAACHQRSAKGNMALGAPDLTDNDWLYGGSGSDITTSIHDG
RSGVMPPWASLGADNVKNLAQYVLSLSGSPHDAAKAAAGQPLFATCAACHGADGKGNQAL
GAPNLTDHIWLHGGSVADIEKTIGEGRQGHMPAWSPRLSDEQIHVLAAYVYHQSHQTSDA
SRQ