Protein Info for OKGIIK_07595 in Rhodanobacter sp. FW510-T8

Name: hyfE
Annotation: formate hydrogenlyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details

Best Hits

KEGG orthology group: K12140, hydrogenase-4 component E [EC: 1.-.-.-] (inferred from 65% identity to tin:Tint_0285)

Predicted SEED Role

"Hydrogenase-4 component E"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>OKGIIK_07595 formate hydrogenlyase (Rhodanobacter sp. FW510-T8)
MMPPLNLATQLLHVLAAGLLMISFAMLAQRRTRRLIVLLAWQGVVLTASTLLVAVTAHLQ
HLYYSAALTLIEKVWLMPWILLRLMRRLGIEGDSDPLVNIPTLMLVGLGLVIFAFGLAQP
ISSLATTVTRQTLGIAMAVILLAFLMMIARHKAVTQVIGFLAMENGLFFAATSTTYGMPM
VIELGIALDLLVGVFIFGIFFFQIREQFDSLDLHQLEALKED