Protein Info for OKGIIK_07540 in Rhodanobacter sp. FW510-T8

Name: mntH
Annotation: iron transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 49 to 71 (23 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 295 to 321 (27 residues), see Phobius details amino acids 341 to 360 (20 residues), see Phobius details amino acids 366 to 387 (22 residues), see Phobius details amino acids 406 to 426 (21 residues), see Phobius details PF01566: Nramp" amino acids 36 to 400 (365 residues), 277 bits, see alignment E=1.2e-86

Best Hits

KEGG orthology group: None (inferred from 60% identity to bcm:Bcenmc03_1691)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>OKGIIK_07540 iron transporter (Rhodanobacter sp. FW510-T8)
MAVRENTEDGGPETPPWASLGAGLITGAADDDPSGIATYSQVGAAFGYGMLWAALVTMPL
MIAIQAISAGIGRVTGHGLMDGMRQHYPRTLVYALLALIFIANVINLAADIGAMGAALKL
LVGGPALLYAAGFAVLSLLLQVFIPFTRYAPILKVLTLSLFAYVATVLVVDVPWHAVLRS
IVLPPISWSAPYAVGLVALLGTTISPYLFCWQASQEVEEIESKVRRQPLQDAPQQAPSAL
RRIGIDTTVGMVFSNLIAFFIILTTAVVLHAHGKTDIQSSAQAAEALRPLAGELAFALFA
AGIIGTGLLAVPVLAGATAYAAAGAFGQRSGLEHKPHEARFFYGVLIGSALLGIALNLTP
LDPIKALYWSAVINGVAAVPLMVAMMLMGSHRKVMGEFTMPWPLKLFGWLATAAMAAAAA
GMFVTWGK