Protein Info for OKGIIK_06925 in Rhodanobacter sp. FW510-T8

Name: kdsB
Annotation: 3-deoxy-manno-octulosonate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR00466: 3-deoxy-D-manno-octulosonate cytidylyltransferase" amino acids 8 to 249 (242 residues), 267.5 bits, see alignment E=4.8e-84 PF02348: CTP_transf_3" amino acids 10 to 228 (219 residues), 180.2 bits, see alignment E=5.2e-57 PF12804: NTP_transf_3" amino acids 17 to 134 (118 residues), 37.4 bits, see alignment E=2.9e-13

Best Hits

Swiss-Prot: 66% identical to KDSB_STRMK: 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K00979, 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) [EC: 2.7.7.38] (inferred from 66% identity to sml:Smlt1642)

MetaCyc: 52% identical to 3-deoxy-manno-octulosonate cytidylyltransferase (Escherichia coli K-12 substr. MG1655)
3-deoxy-manno-octulosonate cytidylyltransferase. [EC: 2.7.7.38]

Predicted SEED Role

"3-deoxy-manno-octulosonate cytidylyltransferase (EC 2.7.7.38)" in subsystem KDO2-Lipid A biosynthesis (EC 2.7.7.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>OKGIIK_06925 3-deoxy-manno-octulosonate cytidylyltransferase (Rhodanobacter sp. FW510-T8)
MPNAVPPFIVAIPARYGSTRLPAKPLRAIDGVPMVVRVAQRALQAGASQVVVAVDDRRIA
DALAGQHGVDICMTRSDHASGSDRLAECASHYGWAADSIVVNLQGDEPFAPAAGIRAVAQ
ALDSDDAPMATLATPIIDAEELFDPNVVKLVRTANGRALYFSRAPLPWARDAFAIDRNAL
PSGSPFLRHIGIYAYRAGFLDRYAGLPRTPLEQTESLEQLRVLEHGHAIAVRLTPEPFPP
GIDTEADLERAEQWLRTQR