Protein Info for OKGIIK_06860 in Rhodanobacter sp. FW510-T8

Name: rnt
Annotation: ribonuclease T

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 TIGR01298: ribonuclease T" amino acids 12 to 207 (196 residues), 316.5 bits, see alignment E=3.7e-99 PF00929: RNase_T" amino acids 22 to 196 (175 residues), 88.1 bits, see alignment E=5e-29

Best Hits

Swiss-Prot: 63% identical to RNT_PSEA7: Ribonuclease T (rnt) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K03683, ribonuclease T [EC: 3.1.13.-] (inferred from 65% identity to sml:Smlt1543)

MetaCyc: 58% identical to ribonuclease T (Escherichia coli K-12 substr. MG1655)
Ribonuclease D. [EC: 3.1.13.5]; 3.1.13.5 [EC: 3.1.13.5]; 3.1.13.- [EC: 3.1.13.5]

Predicted SEED Role

"Ribonuclease T (EC 3.1.13.-)" in subsystem tRNA processing (EC 3.1.13.-)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.13.- or 3.1.13.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>OKGIIK_06860 ribonuclease T (Rhodanobacter sp. FW510-T8)
METPDNSNTPRMADRFRGFLPVVVDVETGGFDAEHDALLEIAAVPLAMDAAGYLYRQPTV
STHVEPFPGANLDPRSLEITGIDPGNPLRGALAERQALDHVFQVVREAVREAGCQRAILV
GHNAAFDLGFLNQAVRRTGHKRNPFHPFSCFDTVSFGGLAYGQTVLSKAVLAAGHAFDSS
EAHSAVYDAERTAELFCSVVNRWRQLEMIEQVHAGLDAA