Protein Info for OKGIIK_06640 in Rhodanobacter sp. FW510-T8

Name: hflK
Annotation: FtsH protease activity modulator HflK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 46 to 67 (22 residues), see Phobius details PF12221: HflK_N" amino acids 2 to 40 (39 residues), 29.9 bits, see alignment 4.5e-11 TIGR01933: HflK protein" amino acids 65 to 311 (247 residues), 307.3 bits, see alignment E=4.4e-96 PF01145: Band_7" amino acids 66 to 234 (169 residues), 108.7 bits, see alignment E=3.6e-35

Best Hits

Swiss-Prot: 40% identical to HFLK_VIBCH: Protein HflK (hflK) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K04088, membrane protease subunit HflK [EC: 3.4.-.-] (inferred from 40% identity to vvm:VVM_00465)

Predicted SEED Role

"HflK protein" in subsystem Hfl operon

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>OKGIIK_06640 FtsH protease activity modulator HflK (Rhodanobacter sp. FW510-T8)
VAWNEPGNNGQRDPWNRNRQGGKSPLDDLLNNARKHLGKLGQGPGSILTGVVVLLIVGLL
FSSYTIIGARQAGVVLRFGEYSRTLPPGFHLKLPQPIESVTKVEATRIRSVTDKVAMLTK
DENIITIDFTVQYQVDDSRKYLFSLNDPDGTIGAAAEAAVRSVIGSSDMDQILSAAGASL
VTQAQETLQKTLDTYDSGLRVTEVSFQNVAPPNEVKDAFDDVNNAREDKQSIENAALAYA
SKVVPVARGDAARIAAEAEGYKAERVARATGDATRFDLLLKQYKAAPEVTRKRLWLETME
QVMAKNPKVIDGSGGRNIINLPALHGSPAAAQPDAGTVGAAVSPPTGNTAGKGTQP