Protein Info for OKGIIK_06155 in Rhodanobacter sp. FW510-T8

Name: lpd
Annotation: NAD(P)/FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 PF07992: Pyr_redox_2" amino acids 7 to 321 (315 residues), 197.2 bits, see alignment E=1.3e-61 PF13738: Pyr_redox_3" amino acids 122 to 304 (183 residues), 36.6 bits, see alignment E=9.8e-13 PF00070: Pyr_redox" amino acids 169 to 241 (73 residues), 60.8 bits, see alignment E=4.5e-20 PF02852: Pyr_redox_dim" amino acids 342 to 447 (106 residues), 76 bits, see alignment E=7.8e-25

Best Hits

KEGG orthology group: K00383, glutathione reductase (NADPH) [EC: 1.8.1.7] (inferred from 73% identity to pbr:PB2503_12394)

Predicted SEED Role

"similar to glutathione reductase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.7

Use Curated BLAST to search for 1.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>OKGIIK_06155 NAD(P)/FAD-dependent oxidoreductase (Rhodanobacter sp. FW510-T8)
MNPNESFDLIVIGAGTGGTGVARMAAAAGWKVAVVDSLPYGGTCALRGCDPKKMLIAVTE
GVDWARNLKGKGLRAQTAVDWPDMIAFKRSFTDLMSGRIEAGMQRAGVVPLHGQARFTGP
NTIEVNGELLTARHFHLATGARPMTLNIPGENLLITSTDFLELPERPDRVVFVGGGFIAM
EFAHICKRAGSRDVTVLEMMKRPLGNFDPDMVGMLSEATADLGIDLRTEARVLTIEQDGA
GFIVTYETPQGTQTIACDRVVHATGRVPNIEHLNLDAAGVAYGRKGIQVSPFMRTTNPAI
FAAGDCADSGPNLTPVSANEGRIAGKNLLAGKDERAIHYPPIPSVVFTLPPVASVGLSED
AAREQGLDFDAHFEITAQWYSSLRVGARHSAYKVLVEKGSGNILGAHLIGPGAEEQINLL
AMAMGAGLTANKLKGIIFAYPSYASDISSMV