Protein Info for OKGIIK_06105 in Rhodanobacter sp. FW510-T8

Annotation: UPF0276 protein CV_3513

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF05114: DUF692" amino acids 17 to 282 (266 residues), 357.2 bits, see alignment E=2.5e-111

Best Hits

Swiss-Prot: 51% identical to Y3513_CHRVO: UPF0276 protein CV_3513 (CV_3513) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K09930, hypothetical protein (inferred from 56% identity to reh:H16_A1821)

Predicted SEED Role

"Uncharacterized protein conserved in bacteria, NMA0228-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>OKGIIK_06105 UPF0276 protein CV_3513 (Rhodanobacter sp. FW510-T8)
MHDASTLAAPPISAPSGVGIGLRAPHMQRVLSERPRVAWFEVHSENLFADGGALHAAIEH
VRADYPLSLHGVGLSLGSADTFDDEHLATLCALVQRFEPGLVSDHICWGAIGGIHLNDLL
PLPFTREALDLIVTRVQQVQDALGREFLVENVSSYLTFQHAEMSEWEFVAELIRRSGCGL
LLDVNNVYVNSVNHGFDAHAYLRAMPRAAVREIHLGGFIRKTDLAVPLLIDSHSRPVDAE
VWALYAGALDLFGPVPTLIEWDQDIPELEVLLAEAGRAEALLNGHRTHIA