Protein Info for OKGIIK_05810 in Rhodanobacter sp. FW510-T8

Name: nuoJ
Annotation: NADH-quinone oxidoreductase subunit J

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 52 (20 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 92 to 115 (24 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details PF00499: Oxidored_q3" amino acids 22 to 169 (148 residues), 126.4 bits, see alignment E=3.8e-41

Best Hits

KEGG orthology group: K00339, NADH dehydrogenase I subunit J [EC: 1.6.5.3] (inferred from 57% identity to xac:XAC2695)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain J (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>OKGIIK_05810 NADH-quinone oxidoreductase subunit J (Rhodanobacter sp. FW510-T8)
MNPQLLQLICFYAFGFVTAAAALSVITLKNSVHAVLALVLTFFSAACLWLLLEAEFLALA
LIVVYVGAVMVLFLFVVMMLDIDQEKLREGFVKFLPVGLIVAAVMLVEMLGLIGVRAMQA
KVMGADPALAAGMSNNTEWLGHALYTKFLLPFEIAALILTVGIVAAVALTLRERRDARYE
SASQQVKVNPRDRVRIVKMAAVRPDEPTAPQEPQP