Protein Info for OKGIIK_05710 in Rhodanobacter sp. FW510-T8
Name: fabD
Annotation: ACP S-malonyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 57% identical to FABD_SALTY: Malonyl CoA-acyl carrier protein transacylase (fabD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: K00645, [acyl-carrier-protein] S-malonyltransferase [EC: 2.3.1.39] (inferred from 71% identity to psu:Psesu_2004)MetaCyc: 57% identical to [acyl-carrier-protein] S-malonyltransferase (Escherichia coli K-12 substr. MG1655)
[Acyl-carrier-protein] S-malonyltransferase. [EC: 2.3.1.39]
Predicted SEED Role
"Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 2.3.1.39)
MetaCyc Pathways
- superpathway of fatty acids biosynthesis (E. coli) (51/53 steps found)
- superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
- superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
- fatty acid biosynthesis initiation (type II) (3/3 steps found)
- superpathway of fatty acid biosynthesis initiation (4/5 steps found)
- fatty acid biosynthesis initiation (mitochondria) (2/4 steps found)
- fatty acid biosynthesis initiation (plant mitochondria) (1/4 steps found)
- mycobactin biosynthesis (1/11 steps found)
- pederin biosynthesis (2/14 steps found)
- bryostatin biosynthesis (2/19 steps found)
- mupirocin biosynthesis (2/26 steps found)
- corallopyronin A biosynthesis (2/30 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.3.1.39
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (315 amino acids)
>OKGIIK_05710 ACP S-malonyltransferase (Rhodanobacter sp. FW510-T8) MSSTSASLAFVFPGQGSQSVGMLAELAAAHAEVQSAFDEASQGAGVDLWALSQQGPEEQL NRTEHTQPALLAASVAVWRVWQKLGGARPAQLSGHSLGEYSALVCAGALSLHDAAALVAE RGRLMQAAVPAGVGAMAAILGGDDVQTAQVCEEVAQGQVVAPANFNSPGQLVIAGNAEAV DRALARLAELGVKKAIKLAVSVPSHCMLMRGAADRLGERMAALSWQLPSIPVIQNAEAKS YATLEEIRGALQRQLYLPVRWTECVQALAAGGATRIAECSPGKVLAGLVKRIDKSVEARA IGTPVEFDAARAEWG