Protein Info for OKGIIK_05260 in Rhodanobacter sp. FW510-T8

Name: moaA
Annotation: GTP 3',8-cyclase MoaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 4 to 326 (323 residues), 322.4 bits, see alignment E=1.5e-100 PF04055: Radical_SAM" amino acids 18 to 175 (158 residues), 106.6 bits, see alignment E=1.6e-34 PF06463: Mob_synth_C" amino acids 184 to 308 (125 residues), 111 bits, see alignment E=4.1e-36

Best Hits

Swiss-Prot: 70% identical to MOAA_STRMK: GTP 3',8-cyclase (moaA) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 70% identity to sml:Smlt2782)

MetaCyc: 52% identical to GTP 3',8'-cyclase (Escherichia coli K-12 substr. MG1655)
RXN-8340 [EC: 4.1.99.22]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>OKGIIK_05260 GTP 3',8-cyclase MoaA (Rhodanobacter sp. FW510-T8)
MRALLDQHGRSFPYLRLSLTEACNYRCTYCLPDGYRATGGAGFLGLAEIERLVRGFAALG
MSKIRLTGGEPSLRKDLAAIIATVAGIPGIRRVALTTNGCRLPRHVCGWREAGLTALNVS
LDSLDAVRYQAITGHDRFVEVTEGIEQALELGFDAVKINAVLLRGHNDDELPAWLAYLRE
RDLAVRFIELMRTGDNREFFERHHVRAESLQQHLLADGWRLRERAPDAGPAHEYVHPDYR
GRIGVITPYARDFCVGCNRLRVTARGDLRLCLFGDFGISLRPLLQSDADHDALVAHIAAQ
LGLKAAGHGLHQGLTGITSHLASIGG