Protein Info for OKGIIK_05245 in Rhodanobacter sp. FW510-T8

Name: moeB
Annotation: molybdopterin-synthase adenylyltransferase MoeB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 163 to 182 (20 residues), see Phobius details PF00581: Rhodanese" amino acids 34 to 123 (90 residues), 48.5 bits, see alignment E=1.1e-16 PF00899: ThiF" amino acids 141 to 377 (237 residues), 258.5 bits, see alignment E=4.6e-81

Best Hits

KEGG orthology group: None (inferred from 58% identity to azl:AZL_022680)

Predicted SEED Role

"Sulfur carrier protein adenylyltransferase ThiF" in subsystem Thiamin biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>OKGIIK_05245 molybdopterin-synthase adenylyltransferase MoeB (Rhodanobacter sp. FW510-T8)
MQKHNGGETQQKEIQSCDSWLDQLRQHVPEVSPAEALAQQALGALLVDVREDAERAAGTV
AHALGLSRGFLELRIEQLQADHDRPMILLCAGGQRSLLAAESLRRLGYRHVSSVAGGFTR
WKTEGLPTVASTLDPDAAERYARQLQLPQVGEKGQARLASAKVVILGAGGLGAPVALYLA
AAGVGRLTLIDDDKVERSNLHRQIVHADARVGMSKTESARIALQALNPRIRIETHAERLG
AGNVERLLAGNDLLIDGADNFPTRYLLATASLRLRIPMIYGAVERFSGQLGVFDPRRDDS
PCYRCLFPIPPAATDAPNCSEAGVLGVLPGIVGLLQATEALKLILGLGEPLTGYLLSFDA
LNMHFHKIRLPRNPLCPGCSDHTPFMGYQQIEASCSSS