Protein Info for OKGIIK_05000 in Rhodanobacter sp. FW510-T8

Name: mtnB
Annotation: methylthioribulose 1-phosphate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00596: Aldolase_II
  • amino acids 20 to 206 (187 residues), 146.6 bits, E=3.8e-47
• TIGR03328: methylthioribulose-1-phosphate dehydratase
  • amino acids 21 to 212 (192 residues), 230 bits, E=8.7e-73

Best Hits

Swiss-Prot: 59% identical to MTNB_XANCP: Methylthioribulose-1-phosphate dehydratase (mtnB) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K08964, methylthioribulose-1-phosphate dehydratase [EC: 4.2.1.109] (inferred from 63% identity to psu:Psesu_1809)

Predicted SEED Role

"Methylthioribulose-1-phosphate dehydratase (EC 4.2.1.109)" in subsystem Methionine Salvage (EC 4.2.1.109)

MetaCyc Pathways

• L-methionine salvage cycle III (10/11 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (6/7 steps found)
• L-methionine salvage cycle I (bacteria and plants) (9/12 steps found)
• L-methionine salvage cycle II (plants) (7/11 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.109

Protein Sequence (216 amino acids)

>OKGIIK_05000 methylthioribulose 1-phosphate dehydratase (Rhodanobacter sp. FW510-T8)
MSQTLPSAVPASLFEQRADAIAEAARELSALGWTPATSSNFSMRVDADHAAITVSGKHKG
RLGRDDIMLIDLDGNPVGTDARPSAETALHTQIYRRWPEVNAVLHTHSHVQSVASRLFAG
GGVIRLQGWELQKAITGYHTHESVLEIPVFPNTQRMPELVARVDAWLDAGKPLHAYLIDG
HGIYTWGRDMAETRRHLEALEFLLGCELDLKRLRAS