Protein Info for OKGIIK_04790 in Rhodanobacter sp. FW510-T8

Name: asd
Annotation: archaetidylserine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00163: phosphatidylserine decarboxylase
  • amino acids 47 to 277 (231 residues), 204.6 bits, E=6.7e-65
• PF02666: PS_Dcarbxylase
  • amino acids 61 to 277 (217 residues), 197.8 bits, E=8.2e-63

Best Hits

Swiss-Prot: 68% identical to PSD_XANC5: Phosphatidylserine decarboxylase proenzyme (psd) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 68% identity to xcv:XCV2880)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Protein Sequence (279 amino acids)

>OKGIIK_04790 archaetidylserine decarboxylase (Rhodanobacter sp. FW510-T8)
MTFNVFLQYILPHRALSRVVYWATRWTFAPWKNWLIATVVRNYDVDMAEAAQPDPLAYQH
FNAFFTRKLKAGARQADADPAALLSPADGRISQAGTIVDGRIFQAKGQEYTAAELLGGDE
AAAAPYRDGRFVTVYLSPRDYHRVHMPLKGTLKETVHVPGRIFSVAPFAVEAIPRLFARN
ERLVCHFEGEHGPFAVVMVGAVLVSSVATVWDGLVIPPYAPSIRRKSFAGQHITLERFAE
MARFNMGSTVILLLPEGAAGLDALQPQQAVRVGQRLGRG