Protein Info for OKGIIK_04690 in Rhodanobacter sp. FW510-T8

Annotation: DUF2147 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF09917: DUF2147" amino acids 29 to 152 (124 residues), 118.4 bits, see alignment E=1.2e-38

Best Hits

KEGG orthology group: None (inferred from 51% identity to hse:Hsero_0425)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>OKGIIK_04690 DUF2147 domain-containing protein (Rhodanobacter sp. FW510-T8)
MKLAVRLTFAAGLLLAAGTALAATDTPAGTWKTIDDATHQPKSIVEITEHNGEYQAKIVK
LLNRTPEDVARDGEHPVCTKCDGERKNQPIVGMTFMWGVSKDGDEWSGGRILDPKNGKVY
KVRLKLMDSGRKLDVHGYIGFALLGRSQVWERQD