Protein Info for OKGIIK_04605 in Rhodanobacter sp. FW510-T8

Annotation: Efflux transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF16576: HlyD_D23" amino acids 121 to 330 (210 residues), 196.4 bits, see alignment E=5.6e-62 PF13533: Biotin_lipoyl_2" amino acids 225 to 256 (32 residues), 29.5 bits, see alignment (E = 7.3e-11) PF13437: HlyD_3" amino acids 226 to 324 (99 residues), 71.4 bits, see alignment E=1.5e-23 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 226 to 404 (179 residues), 141 bits, see alignment E=2.2e-45

Best Hits

KEGG orthology group: K07798, Cu(I)/Ag(I) efflux system membrane protein CusB (inferred from 38% identity to bge:BC1002_7192)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>OKGIIK_04605 Efflux transporter periplasmic adaptor subunit (Rhodanobacter sp. FW510-T8)
MKRVLMMLVAVLLAAALLLIGYFGGRDHSSSTPSQANTTASSPEGGGKKILYWYDTMVPQ
QHFDKPGLSPMGMQMVPKYADEKPADEKPTDEGVAKDVVRIDPATVQNLGVRTAPVERRV
LASAIRVPGTVTWDLRQAITISARTDAVVSKLDVRAPYAVVKAGEPLAELLAPQWSSALA
EYDALQHVQSADAKGLRAASRERLQVLGLTPADIRSSRHGAGAAITLHAPQAGVVTTLDV
REGQRVTAGQTLMTVNGLSTVWIEAALPQAAAGTVRRGTPVVVTVDALPGRSFPGNVETL
LPDVDAMTRTQRARIVLDNPDGGLSPGMFATVQLNPTPDAAVPVVPDDALIATGIHTRVI
LAEGDGHFRAVSVRIGRAAGGYTEILDGLTGGEKVVVSGQFLIDSEASLSGALERLNSTS
AKPVSATSVSMPGMPMGDGR