Protein Info for OKGIIK_03890 in Rhodanobacter sp. FW510-T8

Name: panC
Annotation: pantoate--beta-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00018: pantoate--beta-alanine ligase
  • amino acids 1 to 280 (280 residues), 315.4 bits, E=1.3e-98
• PF02569: Pantoate_ligase
  • amino acids 3 to 278 (276 residues), 350.9 bits, E=2.1e-109

Best Hits

Swiss-Prot: 56% identical to PANC_XANOM: Pantothenate synthetase (panC) from Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

KEGG orthology group: K01918, pantoate--beta-alanine ligase [EC: 6.3.2.1] (inferred from 59% identity to psu:Psesu_1052)

Predicted SEED Role

"Pantoate--beta-alanine ligase (EC 6.3.2.1)" in subsystem Coenzyme A Biosynthesis (EC 6.3.2.1)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• phosphopantothenate biosynthesis I (4/4 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (6/10 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis
• beta-Alanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.1

Protein Sequence (281 amino acids)

>OKGIIK_03890 pantoate--beta-alanine ligase (Rhodanobacter sp. FW510-T8)
MQTVQDAPSLRAAIRGWREKGQTVGFVPTMGNLHAGHQSLIRLARARTERVVASVFVNPT
QFGPNEDYDRYPRTLPQDQAALAEQDCDLLFAPDVATMYPFGPEHSVSVRVPQITDTLEG
AHRPGHFDGMATVVCKLFNLVQPDVAVFGQKDFQQLKVVERMVRDLGLPVKVVAAPILRA
ADGLALSSRNQYLSAEERARAPLIHDTLQKMRGLLAQGHPWQAVEQTAAARLARAGFVPD
YVAIRRVEDLAEPADGEREGLVALVAARLGGTRLIDNLLFD