Protein Info for OKGIIK_03785 in Rhodanobacter sp. FW510-T8

Name: phoR
Annotation: phosphate regulon sensor histidine kinase PhoR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 63 (18 residues), see Phobius details TIGR02966: phosphate regulon sensor kinase PhoR" amino acids 96 to 421 (326 residues), 392.1 bits, see alignment E=9.7e-122 PF00989: PAS" amino acids 100 to 146 (47 residues), 24.9 bits, see alignment 3.4e-09 PF00512: HisKA" amino acids 207 to 269 (63 residues), 71.1 bits, see alignment E=1.3e-23 PF02518: HATPase_c" amino acids 314 to 421 (108 residues), 87.3 bits, see alignment E=2e-28

Best Hits

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>OKGIIK_03785 phosphate regulon sensor histidine kinase PhoR (Rhodanobacter sp. FW510-T8)
MLGLRRPESLRRMSPSATPAAWKLPAALAAGLGGGALLGWLAGGHLAAGIALAAVAEVVL
LLTRIRHQDQTMMDASATATSLQHDRFMTRSRRLASNLRDLRNAVSKLPDAVVLLDEQQQ
VRWFNHAAENLLGLRRPQDRGVSLPQRLAGSELADWLRDGARAPLNDASAPGQADSQINL
SLLPLGDHEQLLLAHDVSHLNRLEQTRRDFVSNVSHELRTPLTVIHGYLELLDPEDVPEL
APVLGEMRAQSKRMGQIVEDLLTLSRLETQHEVVDERVPMEALLATVRKEAEALSQGRHR
IVLESTAGVDLLGSPKDLHSALSNLASNAVRYTPAGGSITIHWQREPTGAAYSVSDTGFG
IPASHLARLTERFYRVSSSRSRETGGTGLGLSIVKHVLNLHQAQLRIQSAPGVGSTFSCH
FGTARLLPPGGNDET