Protein Info for OKGIIK_03735 in Rhodanobacter sp. FW510-T8

Name: pncC
Annotation: damage-inducible protein CinA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02464: CinA
  • amino acids 15 to 167 (153 residues), 195 bits, E=3.1e-62
• TIGR00199: amidohydrolase, PncC family
  • amino acids 21 to 166 (146 residues), 164.8 bits, E=7.4e-53

Best Hits

Swiss-Prot: 52% identical to PNCC_ECOL6: Nicotinamide-nucleotide amidohydrolase PncC (pncC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03743, (no description) (inferred from 69% identity to xal:XALc_1169)

MetaCyc: 52% identical to NMN aminohydrolase (Escherichia coli K-12 substr. MG1655)
Nicotinamide-nucleotide amidase. [EC: 3.5.1.42]

Predicted SEED Role

"C-terminal domain of CinA type S; Protein Implicated in DNA repair function with RecA and MutS"

MetaCyc Pathways

• NAD salvage pathway II (PNC IV cycle) (5/5 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.42

Protein Sequence (169 amino acids)

>OKGIIK_03735 damage-inducible protein CinA (Rhodanobacter sp. FW510-T8)
MESSSVPTDAELLALAGAVADEVQRCRLMLVTAESCTGGWIAKTLTDLPGSSAWFDAGVV
TYSYEAKEALLGVNPRTLEHSGAVSEETALEMVSGALARFGAGVAVAVTGIAGPSGGTPD
KPVGTVWIGWKRRGGYGHARQFHFPGDREAVRRQTVAAALIGLRKTLTE