Protein Info for OKGIIK_03330 in Rhodanobacter sp. FW510-T8

Name: citB
Annotation: DNA-binding response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 PF00072: Response_reg" amino acids 4 to 116 (113 residues), 102 bits, see alignment E=2.1e-33 PF00196: GerE" amino acids 151 to 206 (56 residues), 69.7 bits, see alignment E=1.2e-23

Best Hits

Swiss-Prot: 40% identical to YXJL_BACSU: Uncharacterized transcriptional regulatory protein YxjL (yxjL) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 76% identity to xop:PXO_04459)

Predicted SEED Role

"Two-component system regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (213 amino acids)

>OKGIIK_03330 DNA-binding response regulator (Rhodanobacter sp. FW510-T8)
MISVCLVDDQNLVRQGVRSLLDLAEDIRVVAECADGTQAVADIPRIKPDVVLLDLRMPNM
SGLEVLQALSARNELPPTIILTTFDDDQLVLQGLKAGARGYLLKDVSLEQLVEAVRTVAG
GGSLVAPMVTQRLMAGVARMQNQFTSLEQPDPLTERETEILRLLSGGYSNKEIANSLKVA
EGTVKNHVSNILSKLGVRDRTRAVLKALEMGIV