Protein Info for OKGIIK_02815 in Rhodanobacter sp. FW510-T8

Name: flhA
Annotation: flagellar biosynthesis protein FlhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 697 transmembrane" amino acids 18 to 36 (19 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 69 to 93 (25 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 283 to 301 (19 residues), see Phobius details amino acids 307 to 324 (18 residues), see Phobius details TIGR01398: flagellar biosynthesis protein FlhA" amino acids 21 to 692 (672 residues), 869.2 bits, see alignment E=9.8e-266 PF00771: FHIPEP" amino acids 27 to 686 (660 residues), 903.4 bits, see alignment E=5e-276

Best Hits

KEGG orthology group: K02400, flagellar biosynthesis protein FlhA (inferred from 64% identity to tgr:Tgr7_1335)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (697 amino acids)

>OKGIIK_02815 flagellar biosynthesis protein FlhA (Rhodanobacter sp. FW510-T8)
MTGADVLGNFKHLARRGAGAPVMMLVMLAMLMLPLPPFLLDMLFSFNIALSLVILLAVVY
VMRPLEFAAFPTVVLMATLLRLALNIASTRVVLLHGHDGPGAAGKVIEAFGEFVIGGNFA
VGLVVFAIITIINFVVVTKGATRVSEVTARFTLDAMPGKQMAIDADLNAGLLTQEQARER
RQEVREEADFYGSMDGASKFVRGDATAGILILIINIVGGFFVGVMQHGLSAGEAAKTYTL
LTIGDGLVAQVPALMLSVAAAIIVTRVSKSQDMGKQVIGQVFGQPRALGVAAAVLTVMGL
IPGMPNVAFLLLGASCGGAAWLLLKRERDTRAKLAESIAEKPAAAVAPERVELGWEDVAS
VDPLGLEVGYRLIPLVDVHQGGELMGRIKSVRRKLSQELGFLVPAVHIRDNLDLGPNTYR
ITLMGVPMGEAEVHNERLMAINPGQVHGTLQGIATQDPAFGLEAVWIESGQRELAQSYGY
TVVDPATVIATHLSHILQGHAHELLSHQDVQQLLDRLAATAPKLVEDLVPKRLALGVVVK
VLQNLLAERVPIRNMRSIVESLAEHAGQSQDPGVLTAAVRVALGRQIVQEITGLGTEVPV
ITLAPELEQILLGSLSGGGGVAGAAVEPGLADRLQQSVADAARRQELSGEPAVLLVAPLL
RPWLARFTRHVAQNLHVLAYNEVPDNRRVRLVQALGR