Protein Info for OKGIIK_02795 in Rhodanobacter sp. FW510-T8

Name: fliP
Annotation: flagellar type III secretion system pore protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 45 to 77 (33 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details PF00813: FliP" amino acids 50 to 242 (193 residues), 271.5 bits, see alignment E=2.2e-85 TIGR01103: flagellar biosynthetic protein FliP" amino acids 50 to 246 (197 residues), 284.7 bits, see alignment E=1.9e-89

Best Hits

Swiss-Prot: 58% identical to FLIP_ECO57: Flagellar biosynthetic protein FliP (fliP) from Escherichia coli O157:H7

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 62% identity to mms:mma_1431)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>OKGIIK_02795 flagellar type III secretion system pore protein FliP (Rhodanobacter sp. FW510-T8)
MKSWRWVIAVLLLALPLATLAAPPGIPLVNVQNAPGGGQNWTLSLQVLALMTALTLLPAI
ALMMTSFTRIVIVLGFLRQALGTQSTPPNQVLLGLSLFLTLFVMSPVLNRAWVDGVKPYM
DGQLAAEQALPAAAAPFKRFMLDQTREADLQLFTRLAREKPYAGKADVPFKVAMPAFLTS
ELKTAFQMGFLLFIPFLIIDLVVASVLMSMGMMMVSPMIISLPFKIMLFVLVDGWTLLLG
TLAGSFYT