Protein Info for OKGIIK_02645 in Rhodanobacter sp. FW510-T8

Annotation: Chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01584: CheW
  • amino acids 23 to 156 (134 residues), 92.3 bits, E=2.1e-30
• PF00072: Response_reg
  • amino acids 182 to 298 (117 residues), 52.7 bits, E=4.3e-18

Best Hits

KEGG orthology group: K03415, two-component system, chemotaxis family, response regulator CheV (inferred from 48% identity to tgr:Tgr7_1215)

Predicted SEED Role

"Chemotaxis protein CheV (EC 2.7.3.-)" in subsystem Bacterial Chemotaxis or Flagellar motility (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Protein Sequence (312 amino acids)

>OKGIIK_02645 Chemotaxis protein (Rhodanobacter sp. FW510-T8)
MGGTLLEKVERHTRLAGHNRVAMLLFRLGDEQLFGINVFKVREVMRRPLLERMPGVHALL
AGSCDYRGQTIPVIDLAAALGYAPLRDVESAHLMVTEFSRSMQGFLVADLQRMVQCEGDA
LVAPPSALGFGARVNAVTRVDGLLLAVVDVEHVLASIDAAPAELSEQMQRVAGARSLAPR
RVLVADDSLIARRRLVSLFKQMDIECVVAKDGREALDRLQELAAGDPADGVRLVVSDIEM
PRLDGYALTRAIREAPSLRRLKVVLHSSLSGIFNEAMVKEVKADRFVAKFQPDLLAQAVL
ELLPEPEPAPAD