Protein Info for OKGIIK_02360 in Rhodanobacter sp. FW510-T8

Name: pitA
Annotation: inorganic phosphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 43 to 68 (26 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details amino acids 217 to 234 (18 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 345 to 369 (25 residues), see Phobius details PF01384: PHO4" amino acids 18 to 359 (342 residues), 309.4 bits, see alignment E=1.5e-96

Best Hits

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 60% identity to xcv:XCV1745)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>OKGIIK_02360 inorganic phosphate transporter (Rhodanobacter sp. FW510-T8)
MSVVIAVVVIALVFTYINGFHDTANSIATVVATKVLTPGQAVLLAAGTNLVGAFLGTAVA
ATIASGLINAGVVEMGSQLLICALLAAIVWNLITWWLGLPSSSSHALVGALVGAAMAASG
NRFDAVVWAEGSWLKGHGVIPKVMIPMVLSPLAGFVIGFLLMGALYALLAWFANRRGWSR
RFGRTPFVNAFFGKAQIVSASAMGVAHGMNDAQKSMGIIALALAGATAAHQFDHLPAWLG
FLRVDGNPAGGFEIPVWVKVVSALTMAAGTAGGGWRIIKTLGHKMVKLHPINGFAAETSS
ALVILSASAFGIPVSTTHNVSASIMGVGAAKRFNSIRWSVVERMVWAWILTLPVTALLAY
GLVVVFRLVS