Protein Info for OKGIIK_01775 in Rhodanobacter sp. FW510-T8

Annotation: L-lysine exporter family protein LysE/ArgO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 38 to 61 (24 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 112 to 135 (24 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details PF01810: LysE" amino acids 16 to 201 (186 residues), 119.4 bits, see alignment E=7e-39

Best Hits

Swiss-Prot: 48% identical to Y498_MYCBO: Putative amino-acid transporter Mb0498 (BQ2027_MB0498) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 65% identity to sml:Smlt1409)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>OKGIIK_01775 L-lysine exporter family protein LysE/ArgO (Rhodanobacter sp. FW510-T8)
MFTSAYLAGLGAGAGLIVAIGAQNAFVLRQGLQRNHVAAVVLVCILADICLILLGVTGMG
LAVQQHPGLLQWLRYAGATFLAAYATLALWRAWRGESGLQPASDGAGSRRRVVLACLGFT
LLNPHVYLDTVVLLGSLSTQYDGDGRWAFAGGASTASVLWFLSLSYGARALLPVFRSPVA
WRLFDVAVGVLMLALAALLLARRIG