Protein Info for OKGIIK_01625 in Rhodanobacter sp. FW510-T8

Annotation: Hydroxyproline-2-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF05544: Pro_racemase" amino acids 6 to 311 (306 residues), 352.7 bits, see alignment E=9.6e-110

Best Hits

Swiss-Prot: 83% identical to 4HYPE_XANCP: 4-hydroxyproline 2-epimerase (XCC2415) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K01777, proline racemase [EC: 5.1.1.4] (inferred from 82% identity to xcv:XCV2748)

MetaCyc: 56% identical to hydroxyproline 2-epimerase subunit (Pseudomonas putida)
4-hydroxyproline epimerase. [EC: 5.1.1.8]

Predicted SEED Role

"4-hydroxyproline epimerase (EC 5.1.1.8)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 5.1.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.4 or 5.1.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>OKGIIK_01625 Hydroxyproline-2-epimerase (Rhodanobacter sp. FW510-T8)
MHTLDVIDSHTAGEPTRVVVAGFPDLGGDSLARCRERFAAEFDHWRSAIACEPRGSDAMV
GAVLLPARDPRACSGVVFFNNVGYLGMCGHGTIGVVRTLQHLGRIGPGRHYIETPVGTVG
VDLDDDGRVHIDNVESYRHAKDVAVQVPGHGEVRGDVAWGGNWFFITGQAPCPLDLAHQR
ELTAYTEAIRQALEAAGITGAEGGEIDHVEVNGSAPDGSGQARNFVLCPGLAYDRSPCGT
GTSAKLACLAADGKLAEGESWLQQGILGSVFEGSYRRGARGVAPRIAGTAHVIARAQLLI
DPADPFAWGIRAE