Protein Info for OKGIIK_01425 in Rhodanobacter sp. FW510-T8

Annotation: Abortive infection protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 261 to 285 (25 residues), see Phobius details PF02517: Rce1-like" amino acids 136 to 229 (94 residues), 76.3 bits, see alignment E=9e-26

Best Hits

KEGG orthology group: K07052, (no description) (inferred from 40% identity to nar:Saro_2395)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>OKGIIK_01425 Abortive infection protein (Rhodanobacter sp. FW510-T8)
MHDQAIAFTTPPDAPRWQRWLLFSPLARIVIFVAMFLILSLAMGWLLHALGWLGKAAPAT
LHGLAQFLMRALPALLAYLLLVRLVERRPLAELAPRRLLPDGAAGAAAGLLLFSAVVGVL
YLLGSYHVTGTNPHAQWLPALLMAGLGAGIGEELICRGVLFRIVEEALGSWWALLVSALF
FGAVHIGNPGATLWSSAAIAIEAGLLFGMLYHATRSLPACMGLHAAWNFAQGTIYGIPVS
GTRADGWLVSTRSGPDWLSGGAFGAEASVVALALCTLCTIGLLVVARRRGSIVPPAWRR